| Pm7.pt Daily Stats | |
|---|---|
Daily Unique Visitors |
106,607 |
Daily Pageviews |
319,820 |
Daily Revenue |
$ 959.46 |
| Pm7.pt Monthly Stats | |
|---|---|
Monthly Unique Visitors |
3,148,098 |
Monthly Pageviews |
9,444,285 |
Monthly Revenue |
$ 28,332.85 |
| Pm7.pt Yearly Stats | |
|---|---|
Yearly Unique Visitors |
38,937,330 |
Yearly Pageviews |
116,811,856 |
Yearly Revenue |
$ 350,435.57 |
Pm7.pt or simply erothots receives roughly 319,820 pageviews (page impressions) daily from it's 106,607 unique daily visitor. Invalid date format. and it's hosted on the IP Address Unknown in Unknown, XX. It has an estimated worth of $ 269,930.86 and a global Alexa rank of 3,518,513.
Updated 4 months ago
| Domain name | Pm7.pt |
| Title |
PM7 - Project Management |
| Keywords |
|
| Description |
| IP Address | Unknown |
| Country |
XX
|
| Region | Unknown |
| City | Unknown |
| www.m7.pt | www.p7m.pt |
| www.p7.pt | www.om7.pt |
| www.pm.pt | www.lm7.pt |
| www.ppm7.pt | www.pn7.pt |
| www.pmm7.pt | www.pj7.pt |
| www.pm77.pt | www.pk7.pt |
| www.mp7.pt |
| Website | Last Visit |
|---|---|
| carpetcleaningsouthfield.com | 1 Sec ago |
| dev-sentranllc.pantheonsite.io | 3 Sec ago |
| engltalk.co.kr | 4 Sec ago |
| tvshdtvsplasmaledlcdflatscreentv.weebly.com | 7 Sec ago |
| adventhealthcardiovascularinstitute.com | 9 Sec ago |